PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna23541.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YB
Protein Properties Length: 187aa    MW: 19756.1 Da    PI: 6.7912
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna23541.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1841.2e-5722117297
                    NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                              reqdr+lPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplkvyl
  mrna23541.1-v1.0-hybrid  22 REQDRLLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYL 107
                              89************************************************************************************ PP

                    NF-YB  88 kkyrelegek 97 
                              +++re+egek
  mrna23541.1-v1.0-hybrid 108 QRFREMEGEK 117
                              ********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.1E-5517127IPR009072Histone-fold
SuperFamilySSF471137.92E-4124127IPR009072Histone-fold
PfamPF008081.0E-272791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.0E-215573No hitNo description
PROSITE patternPS0068505874IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.0E-217492No hitNo description
PRINTSPR006157.0E-2193111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MADSDNDSGG GHNSPKSELS PREQDRLLPI ANVSRIMKKA LPANAKISKD AKETVQECVS  60
EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFEEYV EPLKVYLQRF REMEGEKSSM  120
AARDKDSSGG VVGFEGGGAG AGGGGVYWQQ QPQPGHVYGG GGFHQMGVGG VGIGKGGSGT  180
NMGRPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B8e-4819112194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A8e-4819112194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0178302e-80BT017830.1 Zea mays clone EL01N0508H10.c mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291567.11e-135PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233107e-72NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLM5WHU04e-93M5WHU0_PRUPE; Uncharacterized protein
STRINGGLYMA18G08620.13e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.14e-74nuclear factor Y, subunit B3